Anti-H2AFB3 pAb | Gentaur

Gentaur

$340
(No reviews yet) Write a Review
SKU:
513-DPAB-DC3438-GEN
Availability:
IN STOCK
Size:
100 µg
Adding to cart… The item has been added

Anti-H2AFB3 pAb

Host Species Mouse

Species Reactivity Human

Immunogen H2AFB3 (NP_542451, 19 a.a. ~ 115 a.a) partial recombinant protein with GST tag. The sequence is TCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED

Conjugate Unconjugated

Target


Alternative Names H2AFB3; H2A histone family, member B3; H2AFB; H2ABBD; histone H2A-Bbd type 2/3; H2A.Bbd